PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID EMT10262
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Pooideae; Triticodae; Triticeae; Triticinae; Aegilops
Family VOZ
Protein Properties Length: 458aa    MW: 51895 Da    PI: 5.8481
Description VOZ family protein
Gene Model
Gene Model ID Type Source Coding Sequence
EMT10262genomeBGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1VOZ420.62.5e-1291633801217
       VOZ   1 pppsaflgpkcalwdctrpaqgsewlqdycssfhatlalne.glpgttpvlrpkgidlkdgllfaalsakvqgkevgipecegaatakspwnaaelfdlsl 100
               p+p++fl+pkcalwdc+rpaqgse +qdycs++ha+la++e g+pgt+pv+rp+gidlkdg+lfaalsak+qgk+vg+p+cegaat+kspwna+elfdl +
  EMT10262 163 PAPASFLRPKCALWDCPRPAQGSESWQDYCSMYHAELAVKEeGPPGTMPVIRPRGIDLKDGPLFAALSAKIQGKHVGVPVCEGAATTKSPWNAPELFDLYI 263
               89*************************************9879********************************************************** PP

       VOZ 101 legetirewlffdkprrafesgnrkqrslpdysgrgwhesrkqvmkefgglkrsyymdpqpsssfewhlyeyeineldalalyrlelklvdekksakgkvs 201
               +ege++rewlffdkprraf+sgnrkqrslpdy+grgwhesrkqvmk+fgglkrsyymdpqpsss+ewhlyeyein+ da+alyrle+k++++kksak+k +
  EMT10262 264 FEGESMREWLFFDKPRRAFDSGNRKQRSLPDYNGRGWHESRKQVMKDFGGLKRSYYMDPQPSSSYEWHLYEYEINDRDAFALYRLEFKSSEAKKSAKSKFT 364
               ***************************************************************************************************** PP

       VOZ 202 kdsladlqkklgrlta 217
               +++l ++q++++rl+a
  EMT10262 365 CSPLIEIQQQMVRLSA 380
               **************97 PP

Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0009408Biological Processresponse to heat
GO:0009414Biological Processresponse to water deprivation
GO:0009631Biological Processcold acclimation
GO:0009816Biological Processdefense response to bacterium, incompatible interaction
GO:0045893Biological Processpositive regulation of transcription, DNA-templated
GO:0048578Biological Processpositive regulation of long-day photoperiodism, flowering
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 458 aa     Download sequence    Send to blast
MRKGPSRSGS ARHQQFRARA KTRVDDLQDM FSGLQYARKE ARSTDAVLLE AQLHQMLREW  60
RAELSVPSPA SSLQAVVFSP EMYYVNQELS VEDFLYDDDY KINLPGSNPE ILNNLEGIGH  120
QEYLQFNLPQ ELPPNAYLDM NNYGQNAGDG FLHMSDLLTT MSPAPASFLR PKCALWDCPR  180
PAQGSESWQD YCSMYHAELA VKEEGPPGTM PVIRPRGIDL KDGPLFAALS AKIQGKHVGV  240
PVCEGAATTK SPWNAPELFD LYIFEGESMR EWLFFDKPRR AFDSGNRKQR SLPDYNGRGW  300
HESRKQVMKD FGGLKRSYYM DPQPSSSYEW HLYEYEINDR DAFALYRLEF KSSEAKKSAK  360
SKFTCSPLIE IQQQMVRLSA DGHVENKRTA RVRTQDVSTN IYPVQNNTAQ ASAPDAYQAA  420
SQVDQMTFLN GSVVYGPHLP YGYSTEGGDF YWNSNDGA
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAK3631850.0AK363185.1 Hordeum vulgare subsp. vulgare mRNA for predicted protein, complete cds, clone: NIASHv2013F10.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_003569827.10.0PREDICTED: transcription factor VOZ1
SwissprotQ9SGQ01e-144VOZ1_ARATH; Transcription factor VOZ1
TrEMBLM8B0L00.0M8B0L0_AEGTA; Uncharacterized protein
STRINGMLOC_75554.10.0(Hordeum vulgare)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP23433888
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G28520.21e-138vascular plant one zinc finger protein